General Information

  • ID:  hor005781
  • Uniprot ID:  P10673
  • Protein name:  Tail peptide
  • Gene name:  NTS
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Neurotensin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence Information

  • Sequence:  GSYYY
  • Length:  5(166-170)
  • Propeptide:  MMAGMKIQLVCMILLAFSSWSLCSDSEEEMKALEADLLTNMHTSKISKASVSSWKMTLLNVCSFVNNLNSQAEETGEFREEELITRRKFPTALDGFSLEAMLTIYQLQKICHSRAFQQWELIQEDVLDAGNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
  • Signal peptide:  MMAGMKIQLVCMILLAFSSWSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P10673-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005781_AF2.pdbhor005781_ESM.pdb

Physical Information

Mass: 72319 Formula: C32H37N5O10
Absent amino acids: ACDEFHIKLMNPQRTVW Common amino acids: Y
pI: 6.08 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 0
Hydrophobicity: -102 Boman Index: -288
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 0
Instability Index: 5736 Extinction Coefficient cystines: 4470
Absorbance 280nm: 1117.5

Literature

  • PubMed ID:  3472221
  • Title:  Cloning and sequence analysis of cDNA for the canine neurotensin/neuromedin N precursor.
  • PubMed ID:  2341398
  • Title:  Differential processing of neurotensin/neuromedin N precursor(s) in canine brain and intestine.
  • PubMed ID:  1883359
  • Title:  Purification of large neuromedin N (NMN) from canine intestine and i
  • PubMed ID:  1494486
  • Title: